Yersinia aleksiciae: ACZ76_17050 Help Entry ACZ76_17050       CDS       T03994                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism yak  Yersinia aleksiciae Pathway yak01100   Metabolic pathways yak01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:yak00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     ACZ76_17050    00074 Mycolic acid biosynthesis     ACZ76_17050   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     ACZ76_17050 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 TerB DUF1896 TMEM210 Motif Other DBs NCBI-ProteinID:  AKP35105 UniProt:  A0A0T9U1C2 LinkDB All DBs Position 3818538..3818774 Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIIVEQLGVKEDEVKNSASFVEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDFINANQQ NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgaagaacgcgttaagaaaatcatcgttgaacaactgggtgttaaagaa gacgaagtgaagaacagtgcttctttcgttgaagatcttggcgcggattctctggacacc gttgagctggtaatggctctggaagaagagtttgatactgagattccagacgaagaagca gagaaaatcactactgttcaggcagctattgattttatcaacgctaatcagcagtaa

DBGET integrated database retrieval system