Salipiger sp. CCB-MM3: AYJ57_05230 Help Entry AYJ57_05230       CDS       T04443                                  Name (GenBank) cyd operon protein YbgT   KO K00424   cytochrome bd-I ubiquinol oxidase subunit X [EC:7.1.1.7] Organism yan  Salipiger sp. CCB-MM3 Pathway yan00190   Oxidative phosphorylation yan01100   Metabolic pathways yan02020   Two-component system Module yan_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:yan00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     AYJ57_05230  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     AYJ57_05230 Enzymes [BR:yan01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      AYJ57_05230 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YbgT_YccB Motif Other DBs NCBI-ProteinID:  ANT59823 UniProt:  A0A1B1PMK0 LinkDB All DBs Position 1:complement(1069780..1069908) Genome browser AA seq 42 aa AA seqDB search MWYFAWMLGLPLAALFAVLNAMWLELREDARMIDEAENGDAR NT seq 129 nt NT seq  +upstreamnt  +downstreamnt atgtggtattttgcctggatgcttggcctgccgctggcggcgctctttgcggtgctgaac gcgatgtggctggaactgcgcgaggatgcgcggatgatcgacgaggcggagaacggcgac gcgcgctga

DBGET integrated database retrieval system