Yersinia alsatica: N0H69_06550 Help Entry N0H69_06550       CDS       T08521                                  Name (GenBank) rod-binding protein   KO K02395   peptidoglycan hydrolase FlgJ Organism yas  Yersinia alsatica Pathway yas02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:yas00001]  09140 Cellular Processes   09142 Cell motility    02040 Flagellar assembly     N0H69_06550  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:yas02035]     N0H69_06550 Bacterial motility proteins [BR:yas02035]  Flagellar system   Flagellar assembly proteins    Rod and hook     N0H69_06550 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Rod-binding TetR_C_7 SDR-like Motif Other DBs NCBI-ProteinID:  UWM46477 LinkDB All DBs Position 1498657..1498950 Genome browser AA seq 97 aa AA seqDB search MIEAIGTSAPVMPGSFAGDLRPENLEQAAVQFEALFMRTLLAQMRKAAEALAADDDPFNS KQQRMMRDFYDDKLASTLASQRSNGIAHLLIQQLGNK NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgattgaagcaattggcacatcagctccggttatgccggggagctttgctggtgatttg cggccagagaatctggaacaggcggcggtgcaatttgaggcgctgtttatgcgcacgcta ctggcacaaatgcgcaaggcagccgaagcattagctgctgatgacgacccttttaatagc aagcaacaacgcatgatgcgtgatttttacgacgacaaactggcctcgactctggcttca cagcgtagcaatggtattgcgcatttactgattcagcaactgggtaataaatag

DBGET integrated database retrieval system