Yersinia canariae: F0T03_09030 Help Entry F0T03_09030       CDS       T06446                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism yca  Yersinia canariae Pathway yca01100   Metabolic pathways yca01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:yca00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     F0T03_09030 (acpP)    00074 Mycolic acid biosynthesis     F0T03_09030 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     F0T03_09030 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 TerB DUF1896 TMEM210 Motif Other DBs NCBI-ProteinID:  QHB32294 UniProt:  A0A857EZ85 LinkDB All DBs Position 1931671..1931907 Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIIVEQLGVKEDEVKNSASFVEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDFINANQQ NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgaagaacgcgttaagaaaatcatcgttgaacaactgggtgttaaagaa gacgaagtgaagaacagtgcttctttcgttgaagatcttggcgcggattctctggacacc gttgagctggtaatggctctggaagaagaatttgatactgagattccagacgaagaagca gagaaaatcactactgttcaggcagctattgattttatcaacgctaaccagcagtaa

DBGET integrated database retrieval system