Yersinia canariae: F0T03_18010 Help Entry F0T03_18010       CDS       T06446                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism yca  Yersinia canariae Pathway yca01100   Metabolic pathways yca01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:yca00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     F0T03_18010    00074 Mycolic acid biosynthesis     F0T03_18010   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     F0T03_18010 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Microp_apicomplexa_17 Motif Other DBs NCBI-ProteinID:  QHB33867 UniProt:  A0A857F2B9 LinkDB All DBs Position complement(3837405..3837653) Genome browser AA seq 82 aa AA seqDB search MSQINPQECWLKSELAQIRAYAGAAQSLDLQARLILDLHIDSLEMLELVSAVENHTQQPL DDKTWMEWYRVQDVLDYLTKGN NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgagccagataaaccctcaggagtgttggcttaaatcagaattagcccagatccgagct tatgctggcgcagcacaaagcttagatttacaagcgcgcctgattcttgatttgcatatc gactctttggagatgctggagttggtatccgcggtggagaatcatacacaacagccgctg gacgataaaacctggatggaatggtatcgggtacaagatgttttggattatttaaccaaa ggtaattga

DBGET integrated database retrieval system