Yersinia enterocolitica FORC_002: FORC2_0903 Help Entry FORC2_0903        CDS       T03890                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism yef  Yersinia enterocolitica FORC_002 Pathway yef01100   Metabolic pathways yef01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:yef00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     FORC2_0903    00074 Mycolic acid biosynthesis     FORC2_0903   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     FORC2_0903 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AKF37050 UniProt:  A0A9P1PSF7 LinkDB All DBs Position 1017845..1018102 Genome browser AA seq 85 aa AA seqDB search MELLSSEIKLLIIDALNLEGMSVDDIDSQAALFGDGLGLDSIDALELGLALKNKYNVVLS AESEDMRQHFYSVKTLAKFISEQRN NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atggaattattgagtagtgagatcaaattactaattattgatgccctaaatctggaaggg atgtcggtggatgatattgattcacaggctgcattatttggtgatggtttaggtttagat tcgattgatgctctggaacttggattagcactcaaaaataaatataacgtcgtgctctct gcggagagtgaagatatgcgccagcacttttattcggtaaaaacgcttgcgaaatttatt tctgaacagcgtaactga

DBGET integrated database retrieval system