Yersinia entomophaga: PL78_01835
Help
Entry
PL78_01835 CDS
T09771
Name
(GenBank) phosphonate ABC transporter ATP-binding protein
KO
K02041
phosphonate transport system ATP-binding protein [EC:
7.3.2.2
]
Organism
yeg
Yersinia entomophaga
Pathway
yeg02010
ABC transporters
Brite
KEGG Orthology (KO) [BR:
yeg00001
]
09130 Environmental Information Processing
09131 Membrane transport
02010 ABC transporters
PL78_01835
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
yeg02000
]
PL78_01835
Enzymes [BR:
yeg01000
]
7. Translocases
7.3 Catalysing the translocation of inorganic anions and their chelates
7.3.2 Linked to the hydrolysis of a nucleoside triphosphate
7.3.2.2 ABC-type phosphonate transporter
PL78_01835
Transporters [BR:
yeg02000
]
ABC transporters, prokaryotic type
Phosphate and amino acid transporters
Phosphonate transporter
PL78_01835
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
ABC_tran
AAA_21
SMC_N
RsgA_GTPase
AAA_29
MMR_HSR1
AAA_30
AAA_16
AAA_22
nSTAND1
AAA_23
nSTAND3
AAA_25
PIF1
Cellulase
DUF7178
bpMoxR
Motif
Other DBs
NCBI-ProteinID:
ANI28577
UniProt:
A0ABN4PMF2
LinkDB
All DBs
Position
378760..379593
Genome browser
AA seq
277 aa
AA seq
DB search
MGQALLQYAPDYPDTAPETKKKVLAVKGLMKAYASQHKVLDNINFELHAGEFVAIIGRSG
AGKSTLLHILNGTISSSGGEILNYQESGETQNIASLTAKQMRKWRAKCGMIFQDFCLVPR
LDVMTNVLLGRLSHTSTLKSFFKIFAERDRARAVELLQWLNMLPHALQRAENLSGGQMQR
VAICRAMMQNPKILLADEPVASLDPKNTTRIMNTLQKISENDIAVVVNLHSVALVKDYCT
RVIGIAQGKIIFDGHPDQLSDSIIHDIYNDEATDVLH
NT seq
834 nt
NT seq
+upstream
nt +downstream
nt
atgggccaggcattacttcaatatgcgccagattatcctgatactgcaccggaaacgaaa
aaaaaggttctggcggttaaaggattgatgaaagcctatgcatcgcagcataaggtgttg
gataacatcaattttgaactccatgctggagaatttgtagcgattattggccgctcaggc
gcaggaaaatcaacgttacttcatatattgaatggcaccatttcttccagcggtggagag
attcttaactatcaggagagtggggaaacgcaaaatattgcctcgctgacggccaaacaa
atgcgtaaatggcgtgccaagtgtggaatgatttttcaggatttctgtctggttcctcgc
ctcgatgttatgaccaatgtgttactcggaagattaagtcatacctcaacgcttaaatca
ttttttaaaatatttgccgagcgtgaccgagccagagccgtcgagctcttgcagtggttg
aatatgttgccacatgcgttgcagcgcgccgaaaatttatccggagggcaaatgcaacgc
gtggctatttgtcgcgcgatgatgcaaaaccctaaaattctattggccgatgagcctgta
gcctccctcgacccaaaaaataccacccgaataatgaatacgctgcaaaaaatcagtgaa
aacgatattgcggtggtggtgaacttacattcggtggcattagttaaagattactgcacg
cgagtgattggtattgcgcaaggaaaaattatatttgacggtcatcctgatcaactaagt
gacagtattattcatgatatttacaacgatgaagcaacagatgttttgcattaa
DBGET
integrated database retrieval system