Yersinia entomophaga: PL78_03115 Help Entry PL78_03115        CDS       T09771                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism yeg  Yersinia entomophaga Pathway yeg01100   Metabolic pathways yeg01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:yeg00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     PL78_03115    00074 Mycolic acid biosynthesis     PL78_03115   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     PL78_03115 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C DUF1896 Motif Other DBs NCBI-ProteinID:  ANI28831 UniProt:  A0ABN4PR47 LinkDB All DBs Position 678690..678926 Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIIVEQLGVKQEEVLNDASFVEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDFINASQQ NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgaagaacgcgttaagaaaatcatcgttgaacaacttggtgttaaacag gaagaagtactgaacgacgcttctttcgtagaagatcttggcgctgattctcttgacacc gttgagctggtaatggctctggaagaagagtttgataccgagattccagacgaagaagca gaaaaaatcactactgttcaggcagctattgattttatcaacgctagtcagcagtaa

DBGET integrated database retrieval system