Yersinia entomophaga: PL78_14620 Help Entry PL78_14620        CDS       T09771                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism yeg  Yersinia entomophaga Pathway yeg01100   Metabolic pathways yeg01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:yeg00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     PL78_14620    00074 Mycolic acid biosynthesis     PL78_14620   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     PL78_14620 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C Motif Other DBs NCBI-ProteinID:  ANI31054 UniProt:  A0ABM6BNZ1 LinkDB All DBs Position 3242704..3242985 Genome browser AA seq 93 aa AA seqDB search MSDTNRFANTHDVLYVGILQWLQKSLVTITNCPLSKINPDARLILDLHIDSLEILELVIE VEKETAKPLADDVWHKWNTINDIVEYIKLTKIR NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgtctgacacaaataggttcgccaacactcacgatgttttatacgttggtatattacaa tggttgcagaaaagtcttgttacgataactaattgtcctctgtcgaaaataaatccggat gccagactaatactggatttgcatatagactctctagaaatattagagttggttattgag gtagagaaagaaacggctaagccgttagctgatgatgtttggcataaatggaatacgata aatgatatcgtagaatatataaaactgacgaagataaggtga

DBGET integrated database retrieval system