Yersinia entomophaga: PL78_18195 Help Entry PL78_18195        CDS       T09771                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism yeg  Yersinia entomophaga Pathway yeg01100   Metabolic pathways yeg01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:yeg00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     PL78_18195    00074 Mycolic acid biosynthesis     PL78_18195   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     PL78_18195 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  ANI31739 UniProt:  A0ABN4Q2N0 LinkDB All DBs Position 4068424..4068681 Genome browser AA seq 85 aa AA seqDB search MKLKDRLDMKAIIDEVLVSCLFCEQVDISPDKHIVNDLYADSVALLDITMALEERFGFDF NKQDIEQFETVGDLYEIVMRNTVTL NT seq 258 nt NT seq  +upstreamnt  +downstreamnt gtgaaattaaaggacagattagatatgaaagcgattattgatgaagttttggtgtcctgc ctattttgtgagcaggttgatatttcaccagataagcacattgttaacgatctttatgct gactccgttgctttgcttgatattacgatggctttggaagaacgattcggatttgatttc aataaacaggatatcgagcagtttgaaaccgttggcgacctttacgaaattgtcatgaga aatacggtaactctttag

DBGET integrated database retrieval system