Yersinia entomophaga: PL78_18285 Help Entry PL78_18285        CDS       T09771                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism yeg  Yersinia entomophaga Pathway yeg01100   Metabolic pathways yeg01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:yeg00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     PL78_18285    00074 Mycolic acid biosynthesis     PL78_18285   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     PL78_18285 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  ANI31757 UniProt:  A0ABN4PXN2 LinkDB All DBs Position 4082118..4082369 Genome browser AA seq 83 aa AA seqDB search MDKQDIYQEVSDLLVKLFEIDRSQITPQARLYEDLELDSIDAVDMVVHLQKKTGRRIKPE SFKSVRTVQDVVDAVEQLLQQPG NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atggataaacaagatatttaccaggaagtgtcggatctcttggtcaaacttttcgaaatc gaccggtcgcagatcacgccgcaggcgcgtctgtatgaagatctggaattagacagtatt gacgccgtggatatggtggttcatttacagaaaaagaccggccgtcggatcaagcctgaa tcctttaagtctgtgcgtaccgtgcaagacgtcgtggatgcggtagaacaattattacag caaccaggctga

DBGET integrated database retrieval system