Yersinia hibernica LC20: LC20_02256 Help Entry LC20_02256        CDS       T03179                                  Name (GenBank) hypothetical protein   KO K02345   DNA polymerase III subunit theta [EC:2.7.7.7] Organism yel  Yersinia hibernica LC20 Pathway yel03030   DNA replication yel03430   Mismatch repair yel03440   Homologous recombination Brite KEGG Orthology (KO) [BR:yel00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     LC20_02256    03430 Mismatch repair     LC20_02256    03440 Homologous recombination     LC20_02256  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:yel03032]     LC20_02256    03400 DNA repair and recombination proteins [BR:yel03400]     LC20_02256 Enzymes [BR:yel01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.7  DNA-directed DNA polymerase      LC20_02256 DNA replication proteins [BR:yel03032]  Prokaryotic type   DNA Replication Elongation Factors    Elongation factors (bacterial)     DNA polymerase III holoenzyme      LC20_02256 DNA repair and recombination proteins [BR:yel03400]  Prokaryotic type   SSBR (single strand breaks repair)    MMR (mismatch excision repair)     DNA polymerase III holoenzyme      LC20_02256 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DNA_pol3_theta Motif Other DBs NCBI-ProteinID:  AHM73509 UniProt:  A0A7U4K148 LinkDB All DBs Position 1975639..1975890 Genome browser AA seq 83 aa AA seqDB search MAGQSDYLPPELPYNICLWPQEYQEKLNLDLRASGLIKNLYERRTHRAHVLEAIERVPVH YREFFKQRLNYWRDRRDHRGETK NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atggccgggcaatcggattatctcccgcccgaactcccgtacaacatttgcctctggcct caggaataccaagaaaagctaaatcttgatctgagagccagcggcttaatcaaaaatctg tacgagcgtagaacccaccgcgcccacgtactggaagcgattgaacgggtaccggtgcat tatcgggaattttttaaacagcgcttaaattactggcgtgaccgtagagaccacagaggc gagaccaaatga

DBGET integrated database retrieval system