Yersinia hibernica LC20: LC20_03345 Help Entry LC20_03345        CDS       T03179                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism yel  Yersinia hibernica LC20 Pathway yel00998   Biosynthesis of various antibiotics yel01100   Metabolic pathways yel01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:yel00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     LC20_03345    00074 Mycolic acid biosynthesis     LC20_03345   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     LC20_03345 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C TerB DUF1896 TMEM210 Motif Other DBs NCBI-ProteinID:  AHM74598 UniProt:  A0A7U4K1U7 LinkDB All DBs Position complement(2866838..2867074) Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIIVEQLGVKEDEVKNSASFVEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDFINANQQ NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgaagaacgcgttaagaaaatcatcgttgaacaactgggtgttaaagaa gacgaagtgaagaacagtgcttctttcgttgaagatcttggcgcggattctctggacacc gttgagctggtaatggctctggaagaagaatttgatactgagattccagacgaagaagca gaaaaaatcactactgttcaggcagctattgattttatcaacgctaaccagcagtaa

DBGET integrated database retrieval system