Yersinia hibernica LC20: LC20_04613 Help Entry LC20_04613        CDS       T03179                                  Name (GenBank) DNA polymerase III subunit psi   KO K02344   DNA polymerase III subunit psi [EC:2.7.7.7] Organism yel  Yersinia hibernica LC20 Pathway yel03030   DNA replication yel03430   Mismatch repair yel03440   Homologous recombination Brite KEGG Orthology (KO) [BR:yel00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     LC20_04613    03430 Mismatch repair     LC20_04613    03440 Homologous recombination     LC20_04613  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:yel03032]     LC20_04613    03400 DNA repair and recombination proteins [BR:yel03400]     LC20_04613 Enzymes [BR:yel01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.7  DNA-directed DNA polymerase      LC20_04613 DNA replication proteins [BR:yel03032]  Prokaryotic type   DNA Replication Elongation Factors    Elongation factors (bacterial)     DNA polymerase III holoenzyme      LC20_04613 DNA repair and recombination proteins [BR:yel03400]  Prokaryotic type   SSBR (single strand breaks repair)    MMR (mismatch excision repair)     DNA polymerase III holoenzyme      LC20_04613 SSDB OrthologParalogGFIT Motif Pfam:  DNA_III_psi Motif Other DBs NCBI-ProteinID:  AHM75866 UniProt:  A0A7U4K2N8 LinkDB All DBs Position complement(4039071..4039508) Genome browser AA seq 145 aa AA seqDB search MASRRDLLLQQLGITQWMLRRPAALQGEIAIRLPDDTRLLIVADPLPESDDPLLCDVLRS LGLTCGQAYVLTPDQVAMLPEETQCNSWRLGISEPLAVAGAQLHSPALAGLYQDASAKRA LWQQICHHEADFYPDASRSGHSVSN NT seq 438 nt NT seq  +upstreamnt  +downstreamnt atggcatcaagacgagacttactgttacaacagcttggcattacgcagtggatgttgcgc cgcccggccgccttgcagggtgaaattgcaatacgcttgcctgatgatacccggctgttg attgtagcagacccgcttcctgaatcagatgacccactgttgtgcgatgtgctgcgcagc ctggggctgacctgcggtcaggcttatgtgctgacgccagatcaggtggcgatgttaccc gaagaaacacagtgcaacagttggcgattgggcatcagtgaaccacttgcggtggcgggt gcacaattacacagcccggcactggccggactttatcaagacgcgagcgctaagcgcgca ctttggcagcagatttgtcaccatgaagcagatttctatcctgacgccagccgatctggc cacagcgtatcaaattga

DBGET integrated database retrieval system