Yersinia enterocolitica 2516-87: CH48_3758 Help Entry CH48_3758         CDS       T03644                                  Symbol ilvN Name (GenBank) acetolactate synthase   KO K01653   acetolactate synthase I/III small subunit [EC:2.2.1.6] Organism yet  Yersinia enterocolitica 2516-87 Pathway yet00290   Valine, leucine and isoleucine biosynthesis yet00650   Butanoate metabolism yet00660   C5-Branched dibasic acid metabolism yet00770   Pantothenate and CoA biosynthesis yet01100   Metabolic pathways yet01110   Biosynthesis of secondary metabolites yet01210   2-Oxocarboxylic acid metabolism yet01230   Biosynthesis of amino acids Module yet_M00019   Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine yet_M00570   Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine Brite KEGG Orthology (KO) [BR:yet00001]  09100 Metabolism   09101 Carbohydrate metabolism    00650 Butanoate metabolism     CH48_3758 (ilvN)    00660 C5-Branched dibasic acid metabolism     CH48_3758 (ilvN)   09105 Amino acid metabolism    00290 Valine, leucine and isoleucine biosynthesis     CH48_3758 (ilvN)   09108 Metabolism of cofactors and vitamins    00770 Pantothenate and CoA biosynthesis     CH48_3758 (ilvN) Enzymes [BR:yet01000]  2. Transferases   2.2  Transferring aldehyde or ketonic groups    2.2.1  Transketolases and transaldolases     2.2.1.6  acetolactate synthase      CH48_3758 (ilvN) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ACT_AHAS_ss ACT_5 ACT ACT_4 Atx10homo_assoc Motif Other DBs NCBI-ProteinID:  AJJ27887 UniProt:  A0A0E1NKA1 LinkDB All DBs Position complement(4125779..4126084) Genome browser AA seq 101 aa AA seqDB search MNSQLVSSARVTLLLTVRNHPGVMSHICGLFARRAFNVDGILCMPLAGGEDSRIWLQVLD DQRLQQMISQLEKLEDVLQVCRFDSEMPIFDQVEDLVANQR NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atgaatagtcaactcgtctcttctgcacgcgtcacgctattgttaacagtgcgcaaccac cctggggtcatgtcccatatctgtggtttatttgcccgccgcgcctttaacgttgacggg atattgtgtatgccgctggctggcggagaagatagccgtatttggttgcaggtattagat gatcagcgtttgcagcaaatgataagccaactggaaaaacttgaagacgtgcttcaggtt tgccgttttgactcagaaatgcctatttttgatcaagttgaagacttagtcgctaatcag cggtaa

DBGET integrated database retrieval system