KEGG   Yersinia enterocolitica WA: CH47_3787
Entry
CH47_3787         CDS       T03643                                 
Symbol
tauD
Name
(GenBank) alpha-ketoglutarate-dependent taurine dioxygenase
  KO
K03119  taurine dioxygenase [EC:1.14.11.17]
Organism
yew  Yersinia enterocolitica WA
Pathway
yew00430  Taurine and hypotaurine metabolism
yew00920  Sulfur metabolism
Brite
KEGG Orthology (KO) [BR:yew00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    CH47_3787 (tauD)
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    CH47_3787 (tauD)
Enzymes [BR:yew01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.17  taurine dioxygenase
     CH47_3787 (tauD)
SSDB
Motif
Pfam: TauD
Other DBs
NCBI-ProteinID: AJI84063
LinkDB
Position
4152704..4153552
AA seq 282 aa
MNERLVVTPLGPHIGALIENVNIARPLGDSQFEQLYHALLKHQVLFFRNQPITPLQQRDL
AGRFGDLHIHPVYPHAKECEEIIVLDTHDNNPPDNDNWHTDVTFIETPPLGAILAAKQLP
STGGDTLWSSGIAAYEALSAPFKQLLAGLQAEHDFTHSFPEHKHRATPEEHQRWLLAKEK
NPPLLHPVVRTHPVSGRQALFVNEGFTTRIVDLSEKESDALLRFLFAHATKPEFQVRWRW
QPDDVAIWDNRVTQHYANADYLPQRRVMHRATILGDKPVFRP
NT seq 849 nt   +upstreamnt  +downstreamnt
atgaatgaacgtttggtagtgacgccattgggaccgcatattggcgctctgattgagaat
gtgaatatcgcccgcccgttgggggatagccagtttgagcagctttatcatgccttgctc
aagcatcaagtcctgtttttccgcaatcaaccgattaccccgttacagcaacgcgattta
gccgggcgctttggtgatttacatattcatccggtttatcctcacgcgaaagagtgtgaa
gagattattgttttagatacgcacgataataatccgccggataatgataattggcacact
gacgtcacttttatcgagacgcctcctttaggtgcgattctggctgcgaagcaattgccg
agcactggcggtgataccttatggagcagcgggattgccgcttatgaagccctttcagcg
ccgtttaaacagcttttagctgggctacaggccgagcacgatttcacccattctttcccc
gagcataagcaccgtgcaacgccagaagagcatcagcgctggttgctggcaaaagagaag
aatccgccattgctccatccggtagtgcgtactcatccggtgagtgggcgtcaggcatta
tttgttaatgaaggattcaccaccagaatagtggatctgagtgagaaagagagcgatgcg
ctactgcgttttctgtttgcacatgccaccaaaccggagtttcaggtgcgctggcgctgg
caaccggatgacgtggctatctgggataaccgcgtcacccaacactatgccaatgccgat
tatctgccgcagcggcgagtgatgcaccgcgcgacgattctcggcgataagccagtattt
cggccttga

DBGET integrated database retrieval system