Yersinia enterocolitica WA: CH47_84 Help Entry CH47_84           CDS       T03643                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism yew  Yersinia enterocolitica WA Pathway yew01100   Metabolic pathways yew01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:yew00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CH47_84    00074 Mycolic acid biosynthesis     CH47_84   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CH47_84 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Peptidase_C28 Motif Other DBs NCBI-ProteinID:  AJI84749 UniProt:  Q8GF02 LinkDB All DBs Position 86171..86422 Genome browser AA seq 83 aa AA seqDB search MKPENSQECWLKSELTQIRAYAGATQHWDMQSRLIVDLHLDSLEMLELVSSVEKHTEQPL QDEIWMKWYRVQDVLDYLEEITH NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgaaaccagaaaactctcaggaatgttggcttaagtcagagctcacccagattcgtgcc tacgcgggcgcaacacaacattgggatatgcaatcgcggctgattgtcgatctccatctt gattcgctggagatgttggagctagtgtcatcggtggaaaaacatacggagcaaccactg caagacgaaatctggatgaaatggtatcgggtacaggatgtactggattatttggaagag atcactcactga

DBGET integrated database retrieval system