Yersinia frederiksenii: AW19_3106 Help Entry AW19_3106         CDS       T03606                                  Symbol zapB Name (GenBank) cell division protein ZapB   KO K09892   cell division protein ZapB Organism yfr  Yersinia frederiksenii Brite KEGG Orthology (KO) [BR:yfr00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:yfr03036]     AW19_3106 (zapB) Chromosome and associated proteins [BR:yfr03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     AW19_3106 (zapB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ZapB Seryl_tRNA_N CtIP_N Leu_zip ERM_helical Cnn_1N Herpes_UL6 PspA_IM30 UPF0242 YabA CC149 XRCC4_CC USHBP1_PDZ-bd DUF3450 Nuf2_DHR10-like DUF6262 DivIC FlaC_arch dCache_2 APG6_N Motif Other DBs NCBI-ProteinID:  AJI87985 LinkDB All DBs Position complement(3378865..3379104) Genome browser AA seq 79 aa AA seqDB search MSFEVFEKLEVKVQQAIDTITLLQMEIEELKEKNNTLSQEVQEAAGGREALVRENEQLKQ EQHVWQDRLRALLGKMEEV NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgtcatttgaagtatttgagaaattggaagttaaagttcagcaggcgattgataccatc actctgttacagatggaaattgaagagctgaaagagaagaataacaccttgtcccaagaa gttcaggaagcggcaggtggccgtgaagcgctagtgcgcgaaaatgagcaattgaaacaa gaacagcatgtttggcaggatcgtctgcgtgctctgttgggaaagatggaagaagtctga

DBGET integrated database retrieval system