Yersinia frederiksenii: AW19_3753 Help Entry AW19_3753         CDS       T03606                                  Symbol hfq Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism yfr  Yersinia frederiksenii Pathway yfr02024   Quorum sensing yfr03018   RNA degradation Brite KEGG Orthology (KO) [BR:yfr00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     AW19_3753 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     AW19_3753 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:yfr03019]     AW19_3753 (hfq)    03036 Chromosome and associated proteins [BR:yfr03036]     AW19_3753 (hfq) Messenger RNA biogenesis [BR:yfr03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      AW19_3753 (hfq) Chromosome and associated proteins [BR:yfr03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     AW19_3753 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Motif Other DBs NCBI-ProteinID:  AJI87585 LinkDB All DBs Position 4045526..4045831 Genome browser AA seq 101 aa AA seqDB search MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQVESFDQFVILLKNTVSQMVYKHAIS TVVPSRPVSHHSNSPSGSTNNYHGSNPSAPQSPQQDSDDAE NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atggctaaggggcaatctttgcaagatccgttcctgaacgcattgcgtcgtgaacgggtt ccggtttctatttatttagtgaatggtattaaactgcagggccaagttgagtcttttgat cagtttgtcattctgttaaaaaatacagtcagccagatggtttataaacacgccatctct actgttgtgccttctcgcccggtttcgcatcacagcaatagtccgagtggtagcactaat aattatcatggtagtaatccatctgcgccgcaatcaccgcagcaggatagcgatgacgct gaataa

DBGET integrated database retrieval system