Yersinia hibernica CFS1934: D5F51_06505 Help Entry D5F51_06505       CDS       T05961                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism yhi  Yersinia hibernica CFS1934 Pathway yhi01100   Metabolic pathways yhi01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:yhi00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     D5F51_06505    00074 Mycolic acid biosynthesis     D5F51_06505   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     D5F51_06505 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 TerB DUF1896 TMEM210 Motif Other DBs NCBI-ProteinID:  QAX78236 LinkDB All DBs Position 1395233..1395469 Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIIVEQLGVKEDEVKNSASFVEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDFINANQQ NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgaagaacgcgttaagaaaatcatcgttgaacaactgggtgttaaagaa gacgaagtgaagaacagtgcttctttcgttgaagatcttggcgcggattctctggacacc gttgagctggtaatggctctggaagaagaatttgatactgagattccagacgaagaagca gaaaaaatcactactgttcaggcagctattgattttatcaacgctaaccagcagtaa

DBGET integrated database retrieval system