Yersinia hibernica CFS1934: D5F51_13175 Help Entry D5F51_13175       CDS       T05961                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism yhi  Yersinia hibernica CFS1934 Pathway yhi01100   Metabolic pathways yhi01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:yhi00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     D5F51_13175    00074 Mycolic acid biosynthesis     D5F51_13175   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     D5F51_13175 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QAX79424 UniProt:  A0ABX5R1W3 LinkDB All DBs Position complement(2770890..2771138) Genome browser AA seq 82 aa AA seqDB search MNDSVINKSVESQVANLIYQVNGILPNDIKPQDSLITDLALDSVELIDLLMRLEEIGVTI PESDISNNLTVGDIIQRVQEVI NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgaatgattcagtaattaataagtctgtagaatcgcaggtggctaaccttatttatcag gttaacggtattttgccaaatgatattaagccgcaggacagtttaattactgacctagcg ctggattctgttgagcttattgatctcttgatgcgcctcgaagaaataggcgtaacgatc ccggaatcagatatcagcaataacctcaccgtcggggatattatccagcgcgtgcaggaa gttatctaa

DBGET integrated database retrieval system