Yinghuangia sp. ASG 101: LO772_34340 Help Entry LO772_34340       CDS       T07749                                  Name (GenBank) acyl carrier protein   KO K05553   minimal PKS acyl carrier protein Organism yia  Yinghuangia sp. ASG 101 Pathway yia00253   Tetracycline biosynthesis yia01056   Biosynthesis of type II polyketide backbone yia01100   Metabolic pathways yia01110   Biosynthesis of secondary metabolites Module yia_M00778   Type II polyketide backbone biosynthesis, acyl-CoA + malonyl-CoA => polyketide Brite KEGG Orthology (KO) [BR:yia00001]  09100 Metabolism   09109 Metabolism of terpenoids and polyketides    01056 Biosynthesis of type II polyketide backbone     LO772_34340    00253 Tetracycline biosynthesis     LO772_34340  09180 Brite Hierarchies   09181 Protein families: metabolism    01004 Lipid biosynthesis proteins [BR:yia01004]     LO772_34340    01008 Polyketide biosynthesis proteins [BR:yia01008]     LO772_34340 Lipid biosynthesis proteins [BR:yia01004]  Polyketide synthase   Component type    LO772_34340 Polyketide biosynthesis proteins [BR:yia01008]  Polyketide synthase (PKS)   Type II PKS    C7-C14 cyclized polyketide type     Octaketide PKS      LO772_34340     Nonaketide PKS      LO772_34340     Decaketide PKS      LO772_34340 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 Motif Other DBs NCBI-ProteinID:  UGQ11793 LinkDB All DBs Position 8010060..8010314 Genome browser AA seq 84 aa AA seqDB search MAELTLDALTDLLRRAAGEGEDVDLDGDILDVPFTELGYDSLAVLELAGMLERDYLVSLS DDAVQEAKTPGQLITLVNSLPAQA NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atggccgaattgacactcgatgcgctgaccgacctcctccgccgcgccgcgggggaaggc gaggacgtcgacctcgacggcgacatcctcgacgtccccttcaccgaactcggctacgac tcgctggccgtgctcgaactcgccggcatgctcgaacgcgattacctcgtcagcctgtcc gacgacgccgtccaggaggcgaagacgccggggcagctgatcaccctcgtcaactcgctt cccgcacaggcctga

DBGET integrated database retrieval system