Yersinia intermedia: CH53_1874 Help Entry CH53_1874         CDS       T03608                                  Symbol grxC Name (GenBank) glutaredoxin 3   KO K03676   glutaredoxin 3 Organism yin  Yersinia intermedia Brite KEGG Orthology (KO) [BR:yin00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:yin03110]     CH53_1874 (grxC) Chaperones and folding catalysts [BR:yin03110]  Protein folding catalysts   Protein disulfide isomerase    CH53_1874 (grxC) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_2 GST_N_3 Glrx-like Thioredoxin_3 GST_N CLIC-like_N Lar_restr_allev DUF7501 SH3BGR Motif Other DBs NCBI-ProteinID:  AJJ18357 UniProt:  A0A0T9MQG8 LinkDB All DBs Position 2124470..2124718 Genome browser AA seq 82 aa AA seqDB search MAKIEIYTKATCPFCHRAKALLNNKGAAFHEIAIDSDPAKREEMIARSGRTTVPQVFIDG QHIGGCDDLHALDARGGLDPLL NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggcgaaaattgagatttataccaaagcaacctgcccgttctgccatcgtgccaaagca ctgctgaacaacaaaggtgctgctttccatgaaatcgcaattgacagtgatccggccaaa cgcgaagagatgattgctcgcagcgggcggacgaccgtgcctcaggtatttattgatggg cagcatatcggtggctgtgatgatttacacgccctggatgcgcgcggtgggcttgatccg ctgctttaa

DBGET integrated database retrieval system