Yersinia rochesterensis: CH54_2728 Help Entry CH54_2728         CDS       T03609                                  Name (GenBank) ACT domain protein   KO K11258   acetolactate synthase II small subunit [EC:2.2.1.6] Organism ykr  Yersinia rochesterensis Pathway ykr00290   Valine, leucine and isoleucine biosynthesis ykr00650   Butanoate metabolism ykr00660   C5-Branched dibasic acid metabolism ykr00770   Pantothenate and CoA biosynthesis ykr01100   Metabolic pathways ykr01110   Biosynthesis of secondary metabolites ykr01210   2-Oxocarboxylic acid metabolism ykr01230   Biosynthesis of amino acids Module ykr_M00019   Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine ykr_M00570   Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine Brite KEGG Orthology (KO) [BR:ykr00001]  09100 Metabolism   09101 Carbohydrate metabolism    00650 Butanoate metabolism     CH54_2728    00660 C5-Branched dibasic acid metabolism     CH54_2728   09105 Amino acid metabolism    00290 Valine, leucine and isoleucine biosynthesis     CH54_2728   09108 Metabolism of cofactors and vitamins    00770 Pantothenate and CoA biosynthesis     CH54_2728 Enzymes [BR:ykr01000]  2. Transferases   2.2  Transferring aldehyde or ketonic groups    2.2.1  Transketolases and transaldolases     2.2.1.6  acetolactate synthase      CH54_2728 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ACT_5 ACT_4 ACT_AHAS_ss Motif Other DBs NCBI-ProteinID:  AJJ37823 UniProt:  A0ABM5STC9 LinkDB All DBs Position 2956409..2956684 Genome browser AA seq 91 aa AA seqDB search MMHHQLSIQHQISIQARFRPEMLERVLRVVRHRGFQVCAMNMSPMINAENVNIELTVASQ RPVDLLSSQLSKLMDVACVEILQPNTLQIRA NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgatgcaccaccaactctctatccaacatcaaatctctatccaagcccgcttccgccct gaaatgttagagcgtgtattgcgggttgtgcggcaccgcggctttcaggtttgtgctatg aatatgtcgccaatgattaatgctgagaatgttaatattgaattgaccgttgccagccag cgccctgtcgatttactgtcttcacagctgagcaagcttatggatgtcgcctgcgtcgag atcctacaacctaatacattacagatacgcgcctga

DBGET integrated database retrieval system