Yersinia rochesterensis: CH54_3203 Help Entry CH54_3203         CDS       T03609                                  Name (GenBank) rod binding family protein   KO K02395   peptidoglycan hydrolase FlgJ Organism ykr  Yersinia rochesterensis Pathway ykr02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:ykr00001]  09140 Cellular Processes   09142 Cell motility    02040 Flagellar assembly     CH54_3203  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:ykr02035]     CH54_3203 Bacterial motility proteins [BR:ykr02035]  Flagellar system   Flagellar assembly proteins    Rod and hook     CH54_3203 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Rod-binding Motif Other DBs NCBI-ProteinID:  AJJ37654 UniProt:  A0A386HH90 LinkDB All DBs Position 3481399..3481692 Genome browser AA seq 97 aa AA seqDB search MIDAISKSAPVVPGSFTGELLPQDLEQAAVQFEAVFMRTLLAQMRKAAEALAADDDPFNS KQQRMMRDFYDDKLASTLASQRSSGIAHLLIQQLGGK NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgattgacgcaataagtaaatcagccccggtggtgccggggagctttaccggagagcta ctgccacaagatcttgagcaggccgcagtgcagtttgaggcggtatttatgcgcacctta ctggcgcaaatgcgcaaagcggctgaagcattggctgccgacgacgacccatttaacagt aaacagcagcgcatgatgcgggatttttatgatgacaaactggcctccactctggcctcg cagcgcagtagtggtatcgctcatttactgattcagcagttaggtgggaaatag

DBGET integrated database retrieval system