Yersinia massiliensis: DA391_16915 Help Entry DA391_16915       CDS       T05402                                  Name (GenBank) DNA-binding protein HU-beta   KO K03530   DNA-binding protein HU-beta Organism yma  Yersinia massiliensis Brite KEGG Orthology (KO) [BR:yma00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:yma03032]     DA391_16915    03036 Chromosome and associated proteins [BR:yma03036]     DA391_16915    03400 DNA repair and recombination proteins [BR:yma03400]     DA391_16915 DNA replication proteins [BR:yma03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     DA391_16915 Chromosome and associated proteins [BR:yma03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     DA391_16915 DNA repair and recombination proteins [BR:yma03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       DA391_16915 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_2 Motif Other DBs NCBI-ProteinID:  AVX39202 UniProt:  A0A0T9PJY3 LinkDB All DBs Position complement(3612991..3613263) Genome browser AA seq 90 aa AA seqDB search MNKSQLIDKIAAGADISKAAAGRALDAIIASVTESLKEGDDVALVGFGTFAVRERSARTG RNPQTGKEISIPAAKVPSFRAGKGLKDAVN NT seq 273 nt NT seq  +upstreamnt  +downstreamnt gtgaataagtcacaactgatcgacaaaattgccgctggtgctgatatttctaaagcggcc gctgggcgtgcattagatgcaattattgcttctgttactgaatctttgaaagaaggtgat gacgtagctctggttggttttggtacttttgcagtccgtgagcgttctgcacgtactggc cgtaaccctcagacaggcaaagaaatcagtattccagcggctaaagtaccaagcttccgc gccggtaaaggtctgaaagacgctgtaaactga

DBGET integrated database retrieval system