Yersinia mollaretii: HRD69_04780 Help Entry HRD69_04780       CDS       T06716                                  Symbol zapB Name (GenBank) cell division protein ZapB   KO K09892   cell division protein ZapB Organism ymo  Yersinia mollaretii Brite KEGG Orthology (KO) [BR:ymo00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ymo03036]     HRD69_04780 (zapB) Chromosome and associated proteins [BR:ymo03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     HRD69_04780 (zapB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ZapB Leu_zip CtIP_N Seryl_tRNA_N XRCC4_CC PspA_IM30 YabA Cnn_1N DUF7801 UPF0242 DUF3450 Herpes_UL6 DivIC CC149 FlaC_arch DUF6262 APG6_N COG3_N Nuf2_DHR10-like bZIP_2 DUF2968 EURL Motif Other DBs NCBI-ProteinID:  QKJ02357 LinkDB All DBs Position 1089474..1089713 Genome browser AA seq 79 aa AA seqDB search MSFEVFEKLEVKVQQAIDTITLLQMEIEELKEKNNTLSQEVQDVAGGREALVRENEQLKQ EQHVWQDRLRALLGKMEEV NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgtcatttgaagtatttgagaaattggaagttaaagttcagcaggcgattgataccatc actttgttacagatggaaattgaagagctgaaagagaaaaataacaccctgtcccaagaa gttcaggatgtagcgggtggccgtgaagccttagtgcgtgaaaatgagcaactaaagcaa gagcaacacgtctggcaggatcgtctgcgggcactgttgggaaagatggaagaagtctaa

DBGET integrated database retrieval system