Yersinia mollaretii: HRD69_17335 Help Entry HRD69_17335       CDS       T06716                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ymo  Yersinia mollaretii Pathway ymo01100   Metabolic pathways ymo01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ymo00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HRD69_17335 (acpP)    00074 Mycolic acid biosynthesis     HRD69_17335 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HRD69_17335 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 TerB DUF1896 TMEM210 Motif Other DBs NCBI-ProteinID:  QKJ04607 LinkDB All DBs Position complement(3881427..3881663) Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIIVEQLGVKEDEVKNSASFVEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDFINANQQ NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgaagaacgcgttaagaaaatcatcgttgaacaactgggtgttaaagaa gacgaagtgaagaacagcgcttctttcgttgaagatcttggcgcggattctctggacacc gttgagctggtaatggctctggaagaagagtttgataccgagattccagacgaagaagca gaaaaaatcactactgttcaggcagctattgattttatcaacgctaatcagcagtaa

DBGET integrated database retrieval system