Alloyangia pacifica: CEW88_06130 Help Entry CEW88_06130       CDS       T05431                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ypac  Alloyangia pacifica Pathway ypac01100   Metabolic pathways ypac01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ypac00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CEW88_06130    00074 Mycolic acid biosynthesis     CEW88_06130   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CEW88_06130 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N ACP_SdgA_C Motif Other DBs NCBI-ProteinID:  AWI83279 UniProt:  A0A1I6WMA6 LinkDB All DBs Position 1:1273975..1274208 Genome browser AA seq 77 aa AA seqDB search MSDIPDRVRKIVVEHLGVEEDKVTESASFIDDLGADSLDTVELVMAFEEEFGIEIPDDAA ETIQTFGDAVKFIKEAS NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagcgatatccctgatcgcgtgcgcaagatcgtggttgagcacctgggcgttgaagaa gacaaggtgaccgagagcgcctcgttcatcgacgatctgggcgcggacagcctcgacacc gtggaactggttatggccttcgaagaagagttcggcatcgagatccccgatgacgcagcc gagaccatccagaccttcggcgacgcggtgaagttcatcaaggaagcctcctga

DBGET integrated database retrieval system