Yersinia pseudotuberculosis 1: BZ23_153 Help Entry BZ23_153          CDS       T03679                                  Symbol ilvN Name (GenBank) acetolactate synthase   KO K01653   acetolactate synthase I/III small subunit [EC:2.2.1.6] Organism ypc  Yersinia pseudotuberculosis 1 Pathway ypc00290   Valine, leucine and isoleucine biosynthesis ypc00650   Butanoate metabolism ypc00660   C5-Branched dibasic acid metabolism ypc00770   Pantothenate and CoA biosynthesis ypc01100   Metabolic pathways ypc01110   Biosynthesis of secondary metabolites ypc01210   2-Oxocarboxylic acid metabolism ypc01230   Biosynthesis of amino acids Module ypc_M00019   Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine ypc_M00570   Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine Brite KEGG Orthology (KO) [BR:ypc00001]  09100 Metabolism   09101 Carbohydrate metabolism    00650 Butanoate metabolism     BZ23_153 (ilvN)    00660 C5-Branched dibasic acid metabolism     BZ23_153 (ilvN)   09105 Amino acid metabolism    00290 Valine, leucine and isoleucine biosynthesis     BZ23_153 (ilvN)   09108 Metabolism of cofactors and vitamins    00770 Pantothenate and CoA biosynthesis     BZ23_153 (ilvN) Enzymes [BR:ypc01000]  2. Transferases   2.2  Transferring aldehyde or ketonic groups    2.2.1  Transketolases and transaldolases     2.2.1.6  acetolactate synthase      BZ23_153 (ilvN) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ALS_ss_C ACT_AHAS_ss ACT ACT_5 ACT_4 ACT_8 Motif Other DBs NCBI-ProteinID:  AJJ69529 UniProt:  A0A0T9JBL1 LinkDB All DBs Position 193127..193621 Genome browser AA seq 164 aa AA seqDB search MRRRILSVLLENESGALSRVVGLFSQRGYNIESLTVAPTDDPTLSRMTIQTVGDAKVLEQ IEKQLHKLVDVLRVSELVSGSHVEREIMLVKLQASGYGREEVKRCAEIFRGQIVDVTATL YTVQLAGTSEKLDAFLNAVREVAEIVEVARSGIVGVSRGDKIMR NT seq 495 nt NT seq  +upstreamnt  +downstreamnt atgcgccgccggattttatcagtactgctggaaaatgagtcaggtgcactctcacgggtg gtggggctgttttctcagcgtggctataatatcgaaagcctgacggtcgcgccaaccgat gacccaacgctttcccgcatgaccatccagaccgtgggtgatgccaaggttctggagcag attgaaaagcagctgcacaagttggtggacgtcttacgtgtcagtgagttggtttctggc tcacatgttgagcgcgaaatcatgttggtgaagttgcaagccagtggttatggccgtgaa gaggtgaagcgttgtgcagaaatcttccgtgggcaaattgtggatgtgaccgcaacgctc tataccgttcagctagcgggtactagcgagaagctggatgcgtttttgaatgcagtgcgt gaagtcgctgaaatagtggaagttgctcgctctgggattgtcggcgtatcgcgtggtgac aaaatcatgcgttaa

DBGET integrated database retrieval system