Yersinia pseudotuberculosis 1: BZ23_302 Help Entry BZ23_302          CDS       T03679                                  Name (GenBank) recX family protein   KO K03565   regulatory protein Organism ypc  Yersinia pseudotuberculosis 1 Brite KEGG Orthology (KO) [BR:ypc00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:ypc03400]     BZ23_302 DNA repair and recombination proteins [BR:ypc03400]  Prokaryotic type   TLS (translesion DNA synthesis) factors    Other SOS response factors     BZ23_302 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  RecX_HTH3 RecX_HTH2 XisI ATG29_N Motif Other DBs NCBI-ProteinID:  AJJ69343 LinkDB All DBs Position 372592..372855 Genome browser AA seq 87 aa AA seqDB search MAVTQNYGQAQRIRSELMQKGVDKERILAAFENSEIDWCQLAKEVAQRKFSETLPVEWKE KAKVQRYLLYRGFFQEEIQSIYTDSVE NT seq 264 nt NT seq  +upstreamnt  +downstreamnt gtggcagttacacagaattatggacaggctcagcgtatccgttcagaactgatgcaaaaa ggtgtcgataaagaacgaattctggctgcttttgagaacagtgagatcgactggtgccaa ctggcaaaagaggtcgcccagcgtaaatttagtgaaactttacctgttgaatggaaagaa aaggctaaagttcagcgttatctcctctatcgtggcttcttccaagaagaaattcagtca atttacactgattctgtcgaatga

DBGET integrated database retrieval system