Yersinia pestis Angola: YpAngola_A0952 Help Entry YpAngola_A0952    CDS       T00635                                  Symbol rpiB Name (GenBank) ribose 5-phosphate isomerase B   KO K01808   ribose 5-phosphate isomerase B [EC:5.3.1.6] Organism ypg  Yersinia pestis Angola Pathway ypg00030   Pentose phosphate pathway ypg00051   Fructose and mannose metabolism ypg00710   Carbon fixation by Calvin cycle ypg01100   Metabolic pathways ypg01110   Biosynthesis of secondary metabolites ypg01120   Microbial metabolism in diverse environments ypg01200   Carbon metabolism ypg01230   Biosynthesis of amino acids Module ypg_M00007   Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P Brite KEGG Orthology (KO) [BR:ypg00001]  09100 Metabolism   09101 Carbohydrate metabolism    00030 Pentose phosphate pathway     YpAngola_A0952 (rpiB)    00051 Fructose and mannose metabolism     YpAngola_A0952 (rpiB)   09102 Energy metabolism    00710 Carbon fixation by Calvin cycle     YpAngola_A0952 (rpiB) Enzymes [BR:ypg01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.1  Interconverting aldoses and ketoses, and related compounds     5.3.1.6  ribose-5-phosphate isomerase      YpAngola_A0952 (rpiB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  LacAB_rpiB Motif Other DBs NCBI-ProteinID:  ABX87504 LinkDB All DBs Position 975665..976120 Genome browser AA seq 151 aa AA seqDB search MLSIAIGCDDAAIEMKNQIVIFLQSKNITVVDYSCDQHQEPTMYPDIAIQVALAIKAGKH ERGILICGTGIGMSISANKVFGVRAAQCHDTFSAQRARKSNNAQIICLGARVIGPELAKT LIEAWLDAEFDGGGSTEKVERIRYYEQSLHD NT seq 456 nt NT seq  +upstreamnt  +downstreamnt atgttatctattgcaatcggctgtgatgatgccgctattgagatgaaaaaccagattgtt atttttctacaaagtaagaacatcactgtcgtcgattacagctgcgatcaacaccaagaa ccgacgatgtaccccgatattgccattcaggttgctctggcgattaaagccgggaaacat gaacgcgggatccttatttgtggaacaggtattgggatgagcatctctgccaataaagtt tttggcgtccgtgcagctcagtgccatgatactttttctgcccaacgagccagaaaaagc aacaatgcccaaattatctgtttaggcgctcgcgttattggcccggagttagccaaaacc ctgatcgaggcttggttagatgctgaatttgacggagggggatcaacggaaaaagtggaa cggatccgctattacgaacagagcctgcatgattga

DBGET integrated database retrieval system