Yoonia phaeophyticola: AABB29_11740 Help Entry AABB29_11740      CDS       T10493                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism yphy  Yoonia phaeophyticola Pathway yphy01100   Metabolic pathways yphy01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:yphy00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AABB29_11740    00074 Mycolic acid biosynthesis     AABB29_11740   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AABB29_11740 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 Motif Other DBs NCBI-ProteinID:  WZC47590 LinkDB All DBs Position complement(3446863..3447123) Genome browser AA seq 86 aa AA seqDB search MSIKDQVIAIIAEQAMLEPTDIQMESTLEDIGIDSLGLVESIFAIEERFDISVPFNANDP GASTFDISSVATIIAAVTQLKEEQSA NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgagcatcaaagatcaggtaatcgcaattatcgccgagcaggccatgcttgagccaaca gatatccagatggaaagcacgcttgaggatatcggcatcgatagcttgggtcttgttgaa agcatctttgcaattgaagagcgtttcgacatttctgtgcctttcaacgcgaatgatccg ggagcaagcacgttcgatatatcgtcggtggccacgatcattgccgctgtgacccagttg aaagaagagcaaagcgcataa

DBGET integrated database retrieval system