KEGG   Yoonia phaeophyticola: AABB29_12400
Entry
AABB29_12400      CDS       T10493                                 
Symbol
coaD
Name
(GenBank) pantetheine-phosphate adenylyltransferase
  KO
K00954  pantetheine-phosphate adenylyltransferase [EC:2.7.7.3]
Organism
yphy  Yoonia phaeophyticola
Pathway
yphy00770  Pantothenate and CoA biosynthesis
yphy01100  Metabolic pathways
yphy01240  Biosynthesis of cofactors
Module
yphy_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:yphy00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    AABB29_12400 (coaD)
Enzymes [BR:yphy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.3  pantetheine-phosphate adenylyltransferase
     AABB29_12400 (coaD)
SSDB
Motif
Pfam: CTP_transf_like
Other DBs
NCBI-ProteinID: WZC47707
UniProt: A0ABZ2UZV7
LinkDB
Position
complement(3309060..3309554)
AA seq 164 aa
MRIGLYPGTFDPVTMGHLDIIRRAGSLVDRLVIGVAINRDKGPLFTLEERVAMIEVECAP
LVQETGCEIVVHPFENLLIDCARDVKASMIIRGLRAVADFEYEYQMVGMNRVLDDSIETV
FLMAEAQHQAIASKLVKEIARLGGDVSKFVTPAVNTALRARFDT
NT seq 495 nt   +upstreamnt  +downstreamnt
atgcgtataggattgtatcccgggacatttgacccggttacgatggggcatcttgatatt
atcagacgcgccggatcgcttgtggaccgtctggtcattggtgtggcgatcaaccgcgac
aaaggccctttgttcactcttgaagagcgcgttgccatgattgaggttgaatgcgcccca
ttggtccaagagaccggctgcgagattgtcgttcatccgtttgagaacctgctgatcgat
tgtgcccgcgacgttaaagcatctatgatcattcgcggcctgcgcgcggtggctgatttt
gagtatgaatatcagatggttggcatgaaccgcgtattggatgacagtattgaaaccgtt
tttttgatggctgaggcgcagcatcaggcgattgcctcaaaattggtcaaggaaatcgcc
cgtttgggcggtgatgtgtcgaaattcgtcacgccagcggtcaataccgcgttacgcgcc
cgttttgatacttga

DBGET integrated database retrieval system