KEGG   Yoonia phaeophyticola: AABB29_13765
Entry
AABB29_13765      CDS       T10493                                 
Symbol
phoB
Name
(GenBank) phosphate regulon transcriptional regulator PhoB
  KO
K07657  two-component system, OmpR family, phosphate regulon response regulator PhoB
Organism
yphy  Yoonia phaeophyticola
Pathway
yphy02020  Two-component system
Brite
KEGG Orthology (KO) [BR:yphy00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AABB29_13765 (phoB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:yphy02022]
    AABB29_13765 (phoB)
Two-component system [BR:yphy02022]
 OmpR family
  PhoR-PhoB (phosphate starvation response)
   AABB29_13765 (phoB)
SSDB
Motif
Pfam: Response_reg Trans_reg_C PDE8A_N SAM_GIDA_C DUF2000 GlnR_1st VpsR
Other DBs
NCBI-ProteinID: WZC47948
UniProt: A0ABZ2V5Y0
LinkDB
Position
3030075..3030761
AA seq 228 aa
MPQQPHVLIVEDEAAQREVLAYNLEAEGFRVTRAENGEEGLLCVQEDTPDVIVLDWMMPN
LSGIEVCRRLKIKPETQAIPIIMLSARSEEVDKVRGLETGADDYVVKPYSVSELMARVRT
QLRRVRPATVGQVLTYDDIVLDAETHRVTRDDNPLKLGPTEFRLLSTFMEKPGRVWSRDM
LLDRVWGRDIYVDTRTVDVHVGRLRKVLTQHGGNDPVRTVRGAGYALG
NT seq 687 nt   +upstreamnt  +downstreamnt
atgccgcaacaaccgcatgtcttgattgtcgaagacgaggccgcccaacgcgaggtgttg
gcctataatctggaagccgagggttttcgtgtcacccgcgctgagaacggcgaagagggg
ttgctttgcgtgcaagaagacacgcccgatgtcattgtgttggactggatgatgcccaac
ctgtccgggattgaggtttgccgccgcttgaaaatcaaacctgaaacccaagcgatcccg
atcatcatgctatccgcccgttcagaagaagttgacaaggtgcgcggtctggaaacgggt
gccgatgactatgtcgtcaaaccttattctgtctccgagctgatggcccgcgtgcgcacc
cagctgcgccgggtacgcccagcgacggtcgggcaggtgctgacctatgatgatatcgtc
ttggatgcggaaacccaccgtgtgacccgtgacgataaccctttgaaactagggccgacc
gagtttcgcctgctgagcacatttatggaaaaacccggccgggtctggtcgcgtgatatg
ctgctcgaccgggtgtgggggcgcgatatctatgtcgatacgcggaccgttgatgtgcat
gtcgggcggttacgcaaagtgttaacgcagcatggcggcaatgatcctgtgcgcaccgtg
cgcggcgcggggtatgcgctgggttga

DBGET integrated database retrieval system