Yoonia phaeophyticola: AABB29_13890 Help Entry AABB29_13890      CDS       T10493                                  Symbol hfq Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism yphy  Yoonia phaeophyticola Pathway yphy02024   Quorum sensing yphy03018   RNA degradation Brite KEGG Orthology (KO) [BR:yphy00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     AABB29_13890 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     AABB29_13890 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:yphy03019]     AABB29_13890 (hfq)    03036 Chromosome and associated proteins [BR:yphy03036]     AABB29_13890 (hfq) Messenger RNA biogenesis [BR:yphy03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      AABB29_13890 (hfq) Chromosome and associated proteins [BR:yphy03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     AABB29_13890 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq Hfq_1 LSM Motif Other DBs NCBI-ProteinID:  WZC47971 UniProt:  A0ABZ2V0J3 LinkDB All DBs Position 3006050..3006283 Genome browser AA seq 77 aa AA seqDB search MAADKANLQDAFLNHVRKTKVPVTIFLVNGVKLQGVITWFDSFCVLLRRDGQSQLVYKSA ISTIMPAQPISLYEGEE NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atggctgccgataaagcaaatctgcaagacgcgtttctgaaccatgtccgtaaaaccaag gtacctgtgaccattttcctcgtgaatggcgtcaaactgcagggcgtgatcacatggttc gacagtttctgcgtgctgctgcgccgtgatgggcaatcgcaattggtctacaaaagcgcg atttccaccatcatgcctgcgcagcccatcagcctttatgaaggtgaagagtag

DBGET integrated database retrieval system