Yoonia phaeophyticola: AABB29_15395 Help Entry AABB29_15395      CDS       T10493                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism yphy  Yoonia phaeophyticola Pathway yphy01100   Metabolic pathways yphy01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:yphy00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AABB29_15395    00074 Mycolic acid biosynthesis     AABB29_15395   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AABB29_15395 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N ACP_SdgA_C TerB Motif Other DBs NCBI-ProteinID:  WZC48239 UniProt:  A0ABZ2V190 LinkDB All DBs Position 2722972..2723205 Genome browser AA seq 77 aa AA seqDB search MSDVADRVRKIVVEHLGVEEDKVTEAASFIDDLGADSLDTVELVMAFEEEFGIEIPDDAA ETIQTFGDAVKFIDGAQ NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagcgacgttgcagaccgcgtacgcaagatcgttgtagagcatcttggtgttgaagaa gacaaagtaaccgaagcggcgtctttcatcgatgaccttggcgctgatagccttgacaca gttgagctggttatggcgttcgaagaagagttcgggatcgaaatccctgatgacgcagcc gaaacgattcagacattcggcgatgcggttaagttcatcgacggcgcacaataa

DBGET integrated database retrieval system