Yersinia pestis Harbin35: CH55_2498 Help Entry CH55_2498         CDS       T03717                                  Symbol ptsO Name (GenBank) phosphocarrier protein NPr   KO K08485   phosphocarrier protein NPr Organism ypj  Yersinia pestis Harbin35 Pathway ypj02060   Phosphotransferase system (PTS) Brite KEGG Orthology (KO) [BR:ypj00001]  09130 Environmental Information Processing   09131 Membrane transport    02060 Phosphotransferase system (PTS)     CH55_2498 (ptsO)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:ypj02000]     CH55_2498 (ptsO) Transporters [BR:ypj02000]  Phosphotransferase system (PTS)   Enzyme I and HPr    Phosphocarrier protein HPr [TC:8.A.8]     CH55_2498 (ptsO) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PTS-HPr Motif Other DBs NCBI-ProteinID:  AJK06236 UniProt:  A0AAX2HWH7 LinkDB All DBs Position 2695368..2695640 Genome browser AA seq 90 aa AA seqDB search MTVKQTVEIKNKLGMHARPAMKLFELVQSFDAEVMLRNDSGTEAEASSVIALLMLDSAKG RQIEVEATGVDEIQALAAVIELFNSGFDED NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgactgtcaaacaaaccgttgagatcaaaaacaagctgggaatgcacgccagacccgcg atgaaattgttcgagctggttcagagttttgatgcagaagtgatgttacgcaatgacagc ggtaccgaagcggaggccagcagcgtcattgcgctgctgatgctggattcagccaaaggc cgccaaatagaggttgaagcaaccggggttgatgaaattcaggcattggcagcggttatc gagttgtttaattcgggatttgacgaagattaa

DBGET integrated database retrieval system