Yersinia pestis Harbin35: CH55_3390 Help Entry CH55_3390         CDS       T03717                                  Symbol hfq Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism ypj  Yersinia pestis Harbin35 Pathway ypj02024   Quorum sensing ypj03018   RNA degradation Brite KEGG Orthology (KO) [BR:ypj00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     CH55_3390 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     CH55_3390 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:ypj03019]     CH55_3390 (hfq)    03036 Chromosome and associated proteins [BR:ypj03036]     CH55_3390 (hfq) Messenger RNA biogenesis [BR:ypj03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      CH55_3390 (hfq) Chromosome and associated proteins [BR:ypj03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     CH55_3390 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 Motif Other DBs NCBI-ProteinID:  AJK07871 LinkDB All DBs Position complement(3679986..3680291) Genome browser AA seq 101 aa AA seqDB search MAKGQSLQNPFLNALRRERVPVSIYLVNGIKLQGQVESFDQFVILLKNTVSQMVYKHAIS TVVPSRPVSHHSNTPSGSTNNYHGSNPSAPQQPQQDSDDAE NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atggctaaggggcaatctttgcaaaatccgttcctgaacgcattgcgtcgtgaacgggtt ccggtttctatttatttagtgaatggtattaaactgcagggccaagttgagtcttttgat cagtttgtcattctgttaaaaaatacagtcagccagatggtttataagcacgccatctct actgttgtgccttctcgtccggtttcgcatcacagcaatactccgagcggtagcaccaat aattatcatggtagtaatccgtctgcgccgcaacagccgcagcaggacagtgatgacgct gaataa

DBGET integrated database retrieval system