Yersinia pestis El Dorado: CH46_2810 Help Entry CH46_2810         CDS       T03719                                  Symbol ilvN Name (GenBank) acetolactate synthase   KO K01653   acetolactate synthase I/III small subunit [EC:2.2.1.6] Organism ypl  Yersinia pestis El Dorado Pathway ypl00290   Valine, leucine and isoleucine biosynthesis ypl00650   Butanoate metabolism ypl00660   C5-Branched dibasic acid metabolism ypl00770   Pantothenate and CoA biosynthesis ypl01100   Metabolic pathways ypl01110   Biosynthesis of secondary metabolites ypl01210   2-Oxocarboxylic acid metabolism ypl01230   Biosynthesis of amino acids Module ypl_M00019   Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine ypl_M00570   Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine Brite KEGG Orthology (KO) [BR:ypl00001]  09100 Metabolism   09101 Carbohydrate metabolism    00650 Butanoate metabolism     CH46_2810 (ilvN)    00660 C5-Branched dibasic acid metabolism     CH46_2810 (ilvN)   09105 Amino acid metabolism    00290 Valine, leucine and isoleucine biosynthesis     CH46_2810 (ilvN)   09108 Metabolism of cofactors and vitamins    00770 Pantothenate and CoA biosynthesis     CH46_2810 (ilvN) Enzymes [BR:ypl01000]  2. Transferases   2.2  Transferring aldehyde or ketonic groups    2.2.1  Transketolases and transaldolases     2.2.1.6  acetolactate synthase      CH46_2810 (ilvN) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ACT_AHAS_ss ACT_5 ACT ACT_4 Motif Other DBs NCBI-ProteinID:  AJJ14301 UniProt:  A0AAX2I1M0 A0A3N4B392 LinkDB All DBs Position complement(3085940..3086242) Genome browser AA seq 100 aa AA seqDB search MINQPIPTRVTLLLTVRNHPGVMSHICGLFARRAFNVEGILCMPLPSGEESRIWLQVLDD QRLLQMISQLEKLVDVLQVRRFGPEMPIFDQVEDLVANQR NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atgataaatcaaccaatacccactcgggtcactctgctcctgacggtgcgtaaccatcca ggtgtgatgtcacatatctgtggcttatttgcccgccgcgcttttaacgttgaaggtatt ctgtgtatgccgctgccaagtggtgaagagagccgtatttggctgcaggttttggatgat caacgcctgctacagatgataagccagctagagaaactggtggatgtgcttcaagtgcgc cgtttcgggccagaaatgccgatttttgatcaagtagaagacttggttgccaatcaaagg tga

DBGET integrated database retrieval system