KEGG   Yersinia pestis 91001 (biovar Microtus): YP_0954
Entry
YP_0954           CDS       T00165                                 
Symbol
phnC
Name
(GenBank) ATP-binding component of phosphonate transport
  KO
K02041  phosphonate transport system ATP-binding protein [EC:7.3.2.2]
Organism
ypm  Yersinia pestis 91001 (biovar Microtus)
Pathway
ypm02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:ypm00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    YP_0954 (phnC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ypm02000]
    YP_0954 (phnC)
Enzymes [BR:ypm01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.2  ABC-type phosphonate transporter
     YP_0954 (phnC)
Transporters [BR:ypm02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphonate transporter
    YP_0954 (phnC)
SSDB
Motif
Pfam: ABC_tran AAA_21 RsgA_GTPase SMC_N AAA_29 MMR_HSR1 nSTAND1 AAA_22 AAA_16 AAA_23 Cellulase AAA_25 AAA_30 dNK nSTAND3 DUF7178 AAA_28
Other DBs
NCBI-ProteinID: AAS61208
UniProt: Q8ZGU5
LinkDB
Position
complement(1030981..1031853)
AA seq 290 aa
MAHDYRQSERLIMGQALRKLTAADYPVVVQEPRKKVLAVKGLVKAYKSQHRVLDNINFEL
HAGEFVAIIGRSGAGKSTLLHILNGTIPTSAGEIINYHENGDTQNIAALTTKQMRKWRAK
CGMIFQDFCLVPRLDVITNVLLGRLSYTSTLKSFFKLFSEQDQARAIELLQWLNMLPHAL
QRAENLSGGQMQRVAICRAMMQNPKILLADEPVASLDPKNTTRIMNTLQKISENDIAVIV
NLHSVDLVKDYCTRVIGIAHGRIIFDGPPSMLNDSIIQDIYSDESAELLH
NT seq 873 nt   +upstreamnt  +downstreamnt
atggctcatgattacaggcaatctgagagactcattatgggccaggcattacgtaaactc
actgcagctgattatccagtagtggtgcaagaaccacgtaaaaaggtacttgctgttaaa
ggattagtaaaagcatataagtcgcagcaccgtgttctggataatattaattttgaacta
cacgctggtgagtttgtggcgataattggtcgttcaggtgcgggtaaatcaacactatta
catattctaaatggtacgatccctaccagcgcgggtgaaattattaattatcatgaaaat
ggtgatacacaaaatattgcggcattgacgacaaagcaaatgcgtaaatggcgcgcaaag
tgtggcatgatttttcaggatttctgtttggttccccgattagatgttatcaccaatgtt
ttattggggcgtctaagttatacatcgacattaaaatcatttttcaaactattttctgag
caagaccaggccagagccatcgaattattgcaatggctgaatatgttgccccacgcattg
cagcgggcagaaaacctctctggtggtcagatgcagcgggtggcgatctgccgtgccatg
atgcagaaccccaaaatattattagctgatgaacctgtcgcatcgttggaccctaaaaat
acgacacgtattatgaatacgttacagaaaatcagtgaaaatgatattgccgtcattgtt
aatttacactcagtcgatttagttaaagattattgcacccgagtgataggcattgctcac
gggcgaattatctttgatgggccacccagtatgctgaatgacagtattattcaagatatt
tatagtgatgagtcagccgagcttttacattaa

DBGET integrated database retrieval system