Yersinia pseudotuberculosis IP 32953 (serotype 1): BZ17_2844
Help
Entry
BZ17_2844 CDS
T03832
Name
(GenBank) putative nitrite transporter
KO
K02598
nitrite transporter
Organism
ypo
Yersinia pseudotuberculosis IP 32953 (serotype 1)
Brite
KEGG Orthology (KO) [BR:
ypo00001
]
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
ypo02000
]
BZ17_2844
Transporters [BR:
ypo02000
]
Other transporters
Pores ion channels [TC:
1
]
BZ17_2844
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Form_Nir_trans
Motif
Other DBs
NCBI-ProteinID:
AJJ54857
UniProt:
Q664M7
LinkDB
All DBs
Position
complement(3196988..3197794)
Genome browser
AA seq
268 aa
AA seq
DB search
MYTDTINKCAANAARIVKLAKESPLGFWIGSAMAGAYVGLGIILIFTLGNLIDPALRPLV
MGATFGLALTLVIIAGSELFTGHTMFLTFGVKAGTIKSSQMWAVLPQTWLGNLLGSVFVA
LLYYYGGGNLLSVDTSLVHTAALAKTTAPAMTLFFKGVLCNWLVCLAIWMAIRVEGAAKF
IAIWWCLLAFIASGYEHSVANMTLLALSWFGHHSEAYTLSGIGHNLLWVTLGNTLSGAVF
MGLGYWYATPRAQRPQPATINAPHSAKS
NT seq
807 nt
NT seq
+upstream
nt +downstream
nt
atgtacactgacaccatcaataaatgcgcggccaatgcggcccgaatcgtcaagctggcc
aaagagagcccactaggtttttggattggttccgccatggcgggtgcctatgtgggcttg
ggtatcatcctgattttcaccttgggtaacctcatcgaccccgcccttcgcccattggtg
atgggggccacctttggtctggctctaacattagtcatcattgccggttctgaattattt
accggtcacaccatgttcctgaccttcggtgtgaaagcaggcaccatcaaatccagccaa
atgtgggcagtattaccgcaaacctggttgggaaatctactggggtcggttttcgttgcc
ctgctctattactacggtggcggcaacctgctctccgtggacaccagcctggtacacacc
gcggcactggcaaaaaccacagcaccggcgatgaccttattctttaaaggcgtcttatgt
aactggctggtttgtctggcgatctggatggcgatccgcgttgaaggcgcggcgaaattt
atcgctatctggtggtgtttgctggcctttattgcctcgggttacgaacactccgtagcg
aacatgaccttgcttgcgttgtcttggtttggccatcacagcgaggcatacaccttaagc
ggcatcggccataacctgttatgggtcacgctgggtaataccctgtcaggcgcggtcttt
atgggcctgggttattggtatgccacccctcgggcgcaacggccacaaccggcaacgatt
aacgccccacacagcgcaaaatcataa
DBGET
integrated database retrieval system