Yersinia pseudotuberculosis EP2/+: BZ20_1278 Help Entry BZ20_1278         CDS       T03678                                  Symbol rpiB Name (GenBank) ribose 5-phosphate isomerase B   KO K01808   ribose 5-phosphate isomerase B [EC:5.3.1.6] Organism ypr  Yersinia pseudotuberculosis EP2/+ Pathway ypr00030   Pentose phosphate pathway ypr00051   Fructose and mannose metabolism ypr00710   Carbon fixation by Calvin cycle ypr01100   Metabolic pathways ypr01110   Biosynthesis of secondary metabolites ypr01120   Microbial metabolism in diverse environments ypr01200   Carbon metabolism ypr01230   Biosynthesis of amino acids Module ypr_M00004   Pentose phosphate pathway (Pentose phosphate cycle) ypr_M00007   Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P Brite KEGG Orthology (KO) [BR:ypr00001]  09100 Metabolism   09101 Carbohydrate metabolism    00030 Pentose phosphate pathway     BZ20_1278 (rpiB)    00051 Fructose and mannose metabolism     BZ20_1278 (rpiB)   09102 Energy metabolism    00710 Carbon fixation by Calvin cycle     BZ20_1278 (rpiB) Enzymes [BR:ypr01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.1  Interconverting aldoses and ketoses, and related compounds     5.3.1.6  ribose-5-phosphate isomerase      BZ20_1278 (rpiB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  LacAB_rpiB Motif Other DBs NCBI-ProteinID:  AJJ05693 LinkDB All DBs Position 1427177..1427632 Genome browser AA seq 151 aa AA seqDB search MLSIAIGCDDAAIEMKNQIVIFLQSKNITVVDYSCDQHQEPTMYPDIAIQVALAIKAGKH ERGILICGTGIGMSISANKVFGVRAAQCHDTFSAQRARKSNNAQIICLGARVIGPELAKT LIEAWLDAEFDGGGSTEKVERIRYYEQSLHD NT seq 456 nt NT seq  +upstreamnt  +downstreamnt atgttatctattgcaatcggctgtgatgatgccgctattgagatgaaaaaccagattgtt atttttctacaaagtaagaacatcactgtcgtcgattacagctgcgatcaacaccaagaa ccgacgatgtaccccgatattgccattcaggttgctctggcgattaaagccgggaaacat gaacgcgggatccttatttgtggaacaggtattgggatgagcatctctgccaataaagtt tttggcgtccgtgcagctcagtgccatgatactttttctgcccaacgagccagaaaaagc aacaatgcccaaattatctgtttaggcgctcgcgttattggcccggagttagccaaaacc ctgatcgaggcttggttagatgctgaatttgacggaggaggatcaacggaaaaagtggaa cggatccgctattacgaacagagcctgcatgattga

DBGET integrated database retrieval system