Yersinia pseudotuberculosis EP2/+: BZ20_4033 Help Entry BZ20_4033         CDS       T03678                                  Symbol ilvN Name (GenBank) acetolactate synthase   KO K01653   acetolactate synthase I/III small subunit [EC:2.2.1.6] Organism ypr  Yersinia pseudotuberculosis EP2/+ Pathway ypr00290   Valine, leucine and isoleucine biosynthesis ypr00650   Butanoate metabolism ypr00660   C5-Branched dibasic acid metabolism ypr00770   Pantothenate and CoA biosynthesis ypr01100   Metabolic pathways ypr01110   Biosynthesis of secondary metabolites ypr01210   2-Oxocarboxylic acid metabolism ypr01230   Biosynthesis of amino acids Module ypr_M00019   Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine ypr_M00570   Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine Brite KEGG Orthology (KO) [BR:ypr00001]  09100 Metabolism   09101 Carbohydrate metabolism    00650 Butanoate metabolism     BZ20_4033 (ilvN)    00660 C5-Branched dibasic acid metabolism     BZ20_4033 (ilvN)   09105 Amino acid metabolism    00290 Valine, leucine and isoleucine biosynthesis     BZ20_4033 (ilvN)   09108 Metabolism of cofactors and vitamins    00770 Pantothenate and CoA biosynthesis     BZ20_4033 (ilvN) Enzymes [BR:ypr01000]  2. Transferases   2.2  Transferring aldehyde or ketonic groups    2.2.1  Transketolases and transaldolases     2.2.1.6  acetolactate synthase      BZ20_4033 (ilvN) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ACT_AHAS_ss ACT_5 ACT ACT_4 Motif Other DBs NCBI-ProteinID:  AJJ06385 UniProt:  A0A0T9J6W7 LinkDB All DBs Position complement(4581033..4581380) Genome browser AA seq 115 aa AA seqDB search MINQQKPTQQASAQHESAQPIPTRVTLLLTVRNHPGVMSHICGLFARRAFNVEGILCMPL PSGEESRIWLQVLDDQRLLQMISQLEKLVDVLQVRRFGPEMPIFDQVEDLVANQR NT seq 348 nt NT seq  +upstreamnt  +downstreamnt atgataaatcaacaaaaacccactcagcaagcatctgctcaacatgaatcagctcaacca atacccactcgggtcactctgctcctgacggtgcgtaaccatccaggtgtgatgtcacat atctgtggcttatttgcccgccgcgcttttaacgttgaaggtattctgtgtatgccgctg ccaagtggtgaagagagccgtatttggctgcaggttttggatgatcaacgcctgctacag atgataagccagctagagaaactggtggatgtgcttcaagtgcgccgtttcgggccagaa atgccgatttttgatcaagtagaagacttggttgccaatcaaaggtga

DBGET integrated database retrieval system