Yersinia pseudotuberculosis EP2/+: BZ20_848 Help Entry BZ20_848          CDS       T03678                                  Name (GenBank) cyd operon protein YbgT   KO K00424   cytochrome bd-I ubiquinol oxidase subunit X [EC:7.1.1.7] Organism ypr  Yersinia pseudotuberculosis EP2/+ Pathway ypr00190   Oxidative phosphorylation ypr01100   Metabolic pathways ypr02020   Two-component system Module ypr_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:ypr00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     BZ20_848  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     BZ20_848 Enzymes [BR:ypr01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      BZ20_848 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YbgT_YccB Motif Other DBs NCBI-ProteinID:  AJJ07821 UniProt:  A0A0T9JUK8 LinkDB All DBs Position complement(946797..946931) Genome browser AA seq 44 aa AA seqDB search MWYFAWILGTLLACSFGIITALALEQSEANAAAKAANNGNDDAV NT seq 135 nt NT seq  +upstreamnt  +downstreamnt atgtggtattttgcctggattctagggacacttctggcctgctcctttggtatcatcact gctctggcattggagcagagtgaagccaacgcagcagctaaagccgctaacaatggcaac gacgatgctgtctga

DBGET integrated database retrieval system