Yersinia pestis A1122: A1122_03385 Help Entry A1122_03385       CDS       T01831                                  Symbol groES Name (GenBank) co-chaperonin GroES   KO K04078   chaperonin GroES Organism ypt  Yersinia pestis A1122 Brite KEGG Orthology (KO) [BR:ypt00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:ypt03110]     A1122_03385 (groES)    03029 Mitochondrial biogenesis [BR:ypt03029]     A1122_03385 (groES) Chaperones and folding catalysts [BR:ypt03110]  Heat shock proteins   HSP10    A1122_03385 (groES) Mitochondrial biogenesis [BR:ypt03029]  Mitochondrial protein import machinery   Matrix    Other matrix factors     A1122_03385 (groES) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cpn10 Motif Other DBs NCBI-ProteinID:  AEL71353 LinkDB All DBs Position complement(744278..744571) Genome browser AA seq 97 aa AA seqDB search MKIRPLHDRVIVKRKEVESKSAGGIVLTGTAAGKSTRGEVLAVGNGRILDNGEIKPLDVK VGDVVIFNDGYGVKAEKIDNEEVLIMSESDILAIVEA NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgaaaattcgtccattgcatgaccgcgttatcgtcaagcgcaaagaagttgaatctaaa tctgctggcggcatcgttctgactggcactgcagcgggtaaatctactcgtggcgaagtc ctggcagtcggcaatggtcgcatcctggataacggtgaaatcaagccgttggatgtgaaa gtcggcgacgtcgtgattttcaacgatggttacggcgtgaaggctgagaagatcgacaat gaagaagtgttgatcatgtccgaaagcgacattctggcaattgttgaagcgtaa

DBGET integrated database retrieval system