KEGG   Yersinia pestis A1122: A1122_16540
Entry
A1122_16540       CDS       T01831                                 
Name
(GenBank) response regulator
  KO
K07689  two-component system, NarL family, invasion response regulator UvrY
Organism
ypt  Yersinia pestis A1122
Pathway
ypt02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ypt00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    A1122_16540
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:ypt02022]
    A1122_16540
Two-component system [BR:ypt02022]
 NarL family
  BarA-UvrY (central carbon metabolism)
   A1122_16540
SSDB
Motif
Pfam: Response_reg GerE Sigma70_r4_2 HTH_23 HTH_Mga HTH_24 HTH_29 HTH_7 cREC_REC Terminase_5
Other DBs
NCBI-ProteinID: AEL73927
LinkDB
Position
complement(3548559..3549215)
AA seq 218 aa
MISVLLVDDHELVRAGIRRILDDIKGIKVAGEMQCGEDAVKWCRSHVVDIVLMDMNMPGI
GGLEATRKILRFSPDTKVIMLTIHTENPLPAKVMQAGAGGYLSKGAAPQDVITAIRMVHA
GQRYIASDIAQQMALSQLEPPAETPFSCLSERELQIMIMITKGQKVNEISEQLHLSPKTV
NSYRYRMFSKLNISGDVELTHLAIRHGLFNAETLSNSD
NT seq 657 nt   +upstreamnt  +downstreamnt
ttgatcagcgttcttcttgttgatgaccacgaattggtgcgcgcagggatacgacgcatt
cttgacgacatcaaaggtatcaaagtcgcgggtgagatgcagtgtggtgaagatgcggtc
aaatggtgccgtagccatgttgtagatatcgtcctgatggatatgaatatgcccggtatt
ggcgggttggaagcaacacgtaaaattttacgtttttcgccggatactaaagttataatg
ctaaccattcatacggagaatccattaccggcaaaggtcatgcaagcgggagcggggggg
tatctcagtaaaggagctgctccgcaggatgttataaccgccatccgtatggtacatgct
gggcaacgttacatagcttctgatattgcacaacaaatggcactgagccagcttgagcct
ccagcagaaacaccttttagctgtttgtcggagcgtgagttgcaaataatgataatgata
acgaaaggccaaaaggtgaatgagatctcagaacagcttcatctgagtccgaaaacggtt
aatagttaccgctaccgtatgttcagtaaactcaatattagtggtgacgttgaattaacc
catttggctattcgccacggtttatttaatgcggagacgttatcaaatagtgactga

DBGET integrated database retrieval system