Yersinia pseudotuberculosis MD67: BZ21_4161 Help Entry BZ21_4161         CDS       T03677                                  Symbol rpiB Name (GenBank) ribose 5-phosphate isomerase B   KO K01808   ribose 5-phosphate isomerase B [EC:5.3.1.6] Organism ypu  Yersinia pseudotuberculosis MD67 Pathway ypu00030   Pentose phosphate pathway ypu00051   Fructose and mannose metabolism ypu00710   Carbon fixation by Calvin cycle ypu01100   Metabolic pathways ypu01110   Biosynthesis of secondary metabolites ypu01120   Microbial metabolism in diverse environments ypu01200   Carbon metabolism ypu01230   Biosynthesis of amino acids Module ypu_M00004   Pentose phosphate pathway (Pentose phosphate cycle) ypu_M00007   Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P Brite KEGG Orthology (KO) [BR:ypu00001]  09100 Metabolism   09101 Carbohydrate metabolism    00030 Pentose phosphate pathway     BZ21_4161 (rpiB)    00051 Fructose and mannose metabolism     BZ21_4161 (rpiB)   09102 Energy metabolism    00710 Carbon fixation by Calvin cycle     BZ21_4161 (rpiB) Enzymes [BR:ypu01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.1  Interconverting aldoses and ketoses, and related compounds     5.3.1.6  ribose-5-phosphate isomerase      BZ21_4161 (rpiB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  LacAB_rpiB Motif Other DBs NCBI-ProteinID:  AJJ04420 LinkDB All DBs Position complement(4708932..4709387) Genome browser AA seq 151 aa AA seqDB search MLSIAIGCDDAAIEMKNQIVIFLQSKNITVVDYSCDQHQEPTMYPDIAIQVALAIKAGKH ERGILICGTGIGMSISANKVFGVRAAQCHDTFSAQRARKSNNAQIICLGARVIGPELAKT LIEAWLDAEFDGGGSTEKVERIRYYEQSLHD NT seq 456 nt NT seq  +upstreamnt  +downstreamnt atgttatctattgcaatcggctgtgatgatgccgctattgagatgaaaaaccagattgtt atttttctacaaagtaagaacatcactgtcgtcgattacagctgcgatcaacaccaagaa ccgacgatgtaccccgatattgccattcaggttgctctggcgattaaagccgggaaacat gaacgcgggatccttatttgtggaacaggtattgggatgagcatctctgccaataaagtt tttggcgtccgtgcagctcagtgccatgatactttttctgcccaacgagccagaaaaagc aacaatgcccaaattatctgtttaggcgctcgcgttattggcccggagttagccaaaacc ctgatcgaggcttggttagatgctgaatttgacggaggaggatcaacggaaaaagtggaa cggatccgctattacgaacagagcctgcatgattga

DBGET integrated database retrieval system