Yersinia pestis Shasta: BZ15_170 Help Entry BZ15_170          CDS       T03718                                  Symbol rpiB Name (GenBank) ribose 5-phosphate isomerase B   KO K01808   ribose 5-phosphate isomerase B [EC:5.3.1.6] Organism ypv  Yersinia pestis Shasta Pathway ypv00030   Pentose phosphate pathway ypv00051   Fructose and mannose metabolism ypv00710   Carbon fixation by Calvin cycle ypv01100   Metabolic pathways ypv01110   Biosynthesis of secondary metabolites ypv01120   Microbial metabolism in diverse environments ypv01200   Carbon metabolism ypv01230   Biosynthesis of amino acids Module ypv_M00004   Pentose phosphate pathway (Pentose phosphate cycle) ypv_M00007   Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P Brite KEGG Orthology (KO) [BR:ypv00001]  09100 Metabolism   09101 Carbohydrate metabolism    00030 Pentose phosphate pathway     BZ15_170 (rpiB)    00051 Fructose and mannose metabolism     BZ15_170 (rpiB)   09102 Energy metabolism    00710 Carbon fixation by Calvin cycle     BZ15_170 (rpiB) Enzymes [BR:ypv01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.1  Interconverting aldoses and ketoses, and related compounds     5.3.1.6  ribose-5-phosphate isomerase      BZ15_170 (rpiB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  LacAB_rpiB Motif Other DBs NCBI-ProteinID:  AJJ49020 UniProt:  A0AAX2HXW4 LinkDB All DBs Position complement(188204..188659) Genome browser AA seq 151 aa AA seqDB search MLSIAIGCDDAAIEMKNQIVIFLQSKNITVVDYSCDQHQEPTMYPDIAIQVALAIKAGKH ERGILICGTGIGMSISANKVFGVRAAQCHDTFSAQRARKSNNAQIICLGARVIGPELAKT LIEAWLDAEFDGGGSTEKVERIRYYEQSLHD NT seq 456 nt NT seq  +upstreamnt  +downstreamnt atgttatctattgcaatcggctgtgatgatgccgctattgagatgaaaaaccagattgtt atttttctacaaagtaagaacatcactgtcgtcgattacagctgcgatcaacaccaagaa ccgacgatgtaccccgatattgccattcaggttgctctggcgattaaagccgggaaacat gaacgcgggatccttatttgtggaacaggtattgggatgagcatctctgccaataaagtt tttggcgtccgtgcagctcagtgccatgatactttttctgcccaacgagccagaaaaagc aacaatgcccaaattatctgtttaggcgctcgcgttattggcccggagttagccaaaacc ctgatcgaggcttggttagatgctgaatttgacggagggggatcaacggaaaaagtggaa cggatccgctattacgaacagagcctgcatgattga

DBGET integrated database retrieval system