Yersinia pestis Shasta: BZ15_1941 Help Entry BZ15_1941         CDS       T03718                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ypv  Yersinia pestis Shasta Pathway ypv01100   Metabolic pathways ypv01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ypv00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BZ15_1941 (acpP)    00074 Mycolic acid biosynthesis     BZ15_1941 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BZ15_1941 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 TerB DUF1896 TMEM210 Motif Other DBs NCBI-ProteinID:  AJJ51747 UniProt:  A0AAX2HYR2 LinkDB All DBs Position 2105324..2105560 Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIIVEQLGVKEDEVKNSASFVEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDFINANQQ NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgaagaacgcgttaagaaaatcatcgttgaacaactgggtgttaaagaa gacgaagtgaagaacagtgcttctttcgttgaagatcttggcgcggattctctggacacc gtcgagctggtaatggctctggaagaagaatttgataccgagattccagacgaagaagca gagaaaatcactactgttcaggcagctattgattttatcaacgctaaccagcagtaa

DBGET integrated database retrieval system